Lineage for d2h3gx1 (2h3g X:1-122)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858526Species Bacillus anthracis [TaxId:198094] [225238] (1 PDB entry)
  8. 1858527Domain d2h3gx1: 2h3g X:1-122 [204509]
    automated match to d3bexa1
    complexed with edo

Details for d2h3gx1

PDB Entry: 2h3g (more details), 2 Å

PDB Description: structure of the type iii pantothenate kinase (coax) from bacillus anthracis
PDB Compounds: (X:) biosynthetic protein

SCOPe Domain Sequences for d2h3gx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3gx1 c.55.1.0 (X:1-122) automated matches {Bacillus anthracis [TaxId: 198094]}
mifvldvgntnavlgvfeegelrqhwrmetdrhktedeygmlvkqlleheglsfedvkgi
ivssvvppimfalermcekyfkikplvvgpgiktglnikyenprevgadrivnavagihl
yg

SCOPe Domain Coordinates for d2h3gx1:

Click to download the PDB-style file with coordinates for d2h3gx1.
(The format of our PDB-style files is described here.)

Timeline for d2h3gx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h3gx2