Lineage for d2h16d_ (2h16 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872193Domain d2h16d_: 2h16 D: [204500]
    automated match to d1uptg_
    complexed with gdp, unx

Details for d2h16d_

PDB Entry: 2h16 (more details), 2 Å

PDB Description: structure of human adp-ribosylation factor-like 5 (arl5)
PDB Compounds: (D:) ADP-ribosylation factor-like protein 5A

SCOPe Domain Sequences for d2h16d_:

Sequence, based on SEQRES records: (download)

>d2h16d_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinntrflmwdiggqeslr
sswntyytntefvivvvdstdrerisvtreelykmlahedlrkagllifankqdvkecmt
vaeisqflkltsikdhqwhiqaccaltgeglcqglewmmsrl

Sequence, based on observed residues (ATOM records): (download)

>d2h16d_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qehkviivgldnagkttilyqfsmnevvhtspnveeivinntrflmwdilrsswntyytn
tefvivvvdstdrerisvtreelykmlahedlrkagllifankqdvkecmtvaeisqflk
ltsikdhqwhiqaccaltgeglcqglewmmsrl

SCOPe Domain Coordinates for d2h16d_:

Click to download the PDB-style file with coordinates for d2h16d_.
(The format of our PDB-style files is described here.)

Timeline for d2h16d_: