SCOPe 2.08: Domain d2h16b_: 2h16 B:

Lineage for d2h16b_ (2h16 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d2h16b_: 2h16 B: [204498]
   automated match to d1uptg_
   complexed with gdp, unx

Details for d2h16b_

PDB Entry: 2h16, 2 Å

PDB Description: structure of human adp-ribosylation factor-like 5 (arl5)

PDB Compounds: (B:) ADP-ribosylation factor-like protein 5A

SCOPe Domain Sequences for d2h16b_:

Sequence, based on SEQRES records:

>d2h16b_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinntrflmwdiggqeslr
sswntyytntefvivvvdstdrerisvtreelykmlahedlrkagllifankqdvkecmt
vaeisqflkltsikdhqwhiqaccaltgeglcqglewmmsrl

Sequence, based on observed residues (ATOM records):

>d2h16b_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qehkviivgldnagkttilyqfsmnevvhtveeivinntrflmwdigsswntyytntefv
ivvvdstdrerisvtreelykmlahedlrkagllifankqdvkecmtvaeisqflkltsi
kdhqwhiqaccaltgeglcqglewmmsrl

Timeline for d2h16b_:

• d2h16b_ first appeared in SCOPe 2.03
  
• d2h16b_ appears in SCOPe 2.07