SCOPe 2.07: Domain d2gr2a3: 2gr2 A:309-400

Lineage for d2gr2a3 (2gr2 A:309-400)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein NADH-dependent ferredoxin reductase, BphA4 [55434] (1 species)

7. Species Pseudomonas sp., KKS102 [TaxId:306] [55435] (9 PDB entries)

8. Domain d2gr2a3: 2gr2 A:309-400 [204460]
   Other proteins in same PDB: d2gr2a1, d2gr2a2, d2gr2a4
   automated match to d1d7ya3
   complexed with apr, fad

Details for d2gr2a3

PDB Entry: 2gr2, 1.85 Å

PDB Description: Crystal structure of Ferredoxin reductase, BphA4 (oxidized form)

PDB Compounds: (A:) Ferredoxin reductase

SCOPe Domain Sequences for d2gr2a3:

Sequence; same for both SEQRES and ATOM records:

>d2gr2a3 d.87.1.1 (A:309-400) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}
tapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivgatcv
nnardfaplrrllavgakpdraaladpatdlr

Timeline for d2gr2a3:

• d2gr2a3 first appeared in SCOPe 2.03
  
• d2gr2a3 appears in SCOPe 2.06
  
• d2gr2a3 appears in the current release, SCOPe 2.08