Lineage for d2gr2a3 (2gr2 A:309-400)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962836Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2962837Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2962950Protein NADH-dependent ferredoxin reductase, BphA4 [55434] (1 species)
  7. 2962951Species Pseudomonas sp., KKS102 [TaxId:306] [55435] (9 PDB entries)
  8. 2962957Domain d2gr2a3: 2gr2 A:309-400 [204460]
    Other proteins in same PDB: d2gr2a1, d2gr2a2, d2gr2a4
    automated match to d1d7ya3
    complexed with apr, fad

Details for d2gr2a3

PDB Entry: 2gr2 (more details), 1.85 Å

PDB Description: Crystal structure of Ferredoxin reductase, BphA4 (oxidized form)
PDB Compounds: (A:) Ferredoxin reductase

SCOPe Domain Sequences for d2gr2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gr2a3 d.87.1.1 (A:309-400) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}
tapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivgatcv
nnardfaplrrllavgakpdraaladpatdlr

SCOPe Domain Coordinates for d2gr2a3:

Click to download the PDB-style file with coordinates for d2gr2a3.
(The format of our PDB-style files is described here.)

Timeline for d2gr2a3: