![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
![]() | Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() both first two domains are of same beta/beta/alpha fold |
![]() | Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
![]() | Protein NADH-dependent ferredoxin reductase, BphA4 [55434] (1 species) |
![]() | Species Pseudomonas sp., KKS102 [TaxId:306] [55435] (9 PDB entries) |
![]() | Domain d2gr2a3: 2gr2 A:309-400 [204460] Other proteins in same PDB: d2gr2a1, d2gr2a2, d2gr2a4 automated match to d1d7ya3 complexed with apr, fad |
PDB Entry: 2gr2 (more details), 1.85 Å
SCOPe Domain Sequences for d2gr2a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gr2a3 d.87.1.1 (A:309-400) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} tapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivgatcv nnardfaplrrllavgakpdraaladpatdlr
Timeline for d2gr2a3: