SCOPe 2.03: Domain d2gb5a3: 2gb5 A:126-257

Lineage for d2gb5a3 (2gb5 A:126-257)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.4: NADH pyrophosphatase [103214] (1 protein)
   duplication: consists of two structurally similar domains separated by a rubredoxin-like zinc finger; the N-terminal domain has a rudiment Nudix fold, the C-terminal, probably catalytic, domain has the canonical fold

6. Protein NADH pyrophosphatase [103215] (1 species)

7. Species Escherichia coli [TaxId:562] [103216] (2 PDB entries)

8. Domain d2gb5a3: 2gb5 A:126-257 [204325]
   Other proteins in same PDB: d2gb5a2, d2gb5b2
   automated match to d1vk6a2
   complexed with zn

Details for d2gb5a3

PDB Entry: 2gb5, 2.3 Å

PDB Description: Crystal structure of NADH pyrophosphatase (EC 3.6.1.22) (1790429) from Escherichia coli K12 at 2.30 A resolution

PDB Compounds: (A:) NADH pyrophosphatase

SCOPe Domain Sequences for d2gb5a3:

Sequence; same for both SEQRES and ATOM records:

>d2gb5a3 d.113.1.4 (A:126-257) NADH pyrophosphatase {Escherichia coli [TaxId: 562]}
qiapciivairrddsillaqhtrhrngvhtvlagfvevgetleqavarevmeesgikvkn
lryvtsqpwpfpqslmtafmaeydsgdividpkelleanwyryddlpllpppgtvarrli
edtvamcraeye

Timeline for d2gb5a3:

• d2gb5a3 is new in SCOPe 2.03-stable
  
• d2gb5a3 appears in SCOPe 2.04
  
• d2gb5a3 appears in the current release, SCOPe 2.08