Lineage for d2gb5a1 (2gb5 A:-7-96)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428504Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1428505Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1428742Family d.113.1.4: NADH pyrophosphatase [103214] (1 protein)
    duplication: consists of two structurally similar domains separated by a rubredoxin-like zinc finger; the N-terminal domain has a rudiment Nudix fold, the C-terminal, probably catalytic, domain has the canonical fold
  6. 1428743Protein NADH pyrophosphatase [103215] (1 species)
  7. 1428744Species Escherichia coli [TaxId:562] [103216] (2 PDB entries)
  8. 1428747Domain d2gb5a1: 2gb5 A:-7-96 [204323]
    Other proteins in same PDB: d2gb5a2, d2gb5b2
    automated match to d1vk6a3
    complexed with zn

Details for d2gb5a1

PDB Entry: 2gb5 (more details), 2.3 Å

PDB Description: Crystal structure of NADH pyrophosphatase (EC 3.6.1.22) (1790429) from Escherichia coli K12 at 2.30 A resolution
PDB Compounds: (A:) NADH pyrophosphatase

SCOPe Domain Sequences for d2gb5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gb5a1 d.113.1.4 (A:-7-96) NADH pyrophosphatase {Escherichia coli [TaxId: 562]}
kihhhhhhmdriiekldhgwwvvsheqklwlpkgelpygeaanfdlvgqralqigewqge
pvwlvqqqrrhdmgsvrqvidldvglfqlagrgvqlaefyrshk

SCOPe Domain Coordinates for d2gb5a1:

Click to download the PDB-style file with coordinates for d2gb5a1.
(The format of our PDB-style files is described here.)

Timeline for d2gb5a1: