Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.4: NADH pyrophosphatase [103214] (1 protein) duplication: consists of two structurally similar domains separated by a rubredoxin-like zinc finger; the N-terminal domain has a rudiment Nudix fold, the C-terminal, probably catalytic, domain has the canonical fold |
Protein NADH pyrophosphatase [103215] (1 species) |
Species Escherichia coli [TaxId:562] [103216] (2 PDB entries) |
Domain d2gb5a1: 2gb5 A:1-96 [204323] Other proteins in same PDB: d2gb5a2, d2gb5a4, d2gb5b2, d2gb5b4 automated match to d1vk6a3 complexed with zn |
PDB Entry: 2gb5 (more details), 2.3 Å
SCOPe Domain Sequences for d2gb5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gb5a1 d.113.1.4 (A:1-96) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} mdriiekldhgwwvvsheqklwlpkgelpygeaanfdlvgqralqigewqgepvwlvqqq rrhdmgsvrqvidldvglfqlagrgvqlaefyrshk
Timeline for d2gb5a1:
View in 3D Domains from other chains: (mouse over for more information) d2gb5b1, d2gb5b2, d2gb5b3, d2gb5b4 |