SCOPe 2.04: Domain d2frma1: 2frm A:17-164

Lineage for d2frma1 (2frm A:17-164)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (18 species)

7. Species Cryptosporidium parvum [TaxId:5807] [225185] (4 PDB entries)

8. Domain d2frma1: 2frm A:17-164 [204261]
   Other proteins in same PDB: d2frma2, d2frmb2, d2frmc2, d2frmd2
   automated match to d1ez4a1

Details for d2frma1

PDB Entry: 2frm, 2.1 Å

PDB Description: Crystal structure of the lactate dehydrogenase from cryptosporidium parvum

PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d2frma1:

Sequence; same for both SEQRES and ATOM records:

>d2frma1 c.2.1.5 (A:17-164) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
tnpldvmvshfqkvsglphnkvcgma

Timeline for d2frma1:

• d2frma1 first appeared in SCOPe 2.03
  
• d2frma1 does not appear in SCOPe 2.05