Lineage for d2frma1 (2frm A:17-164)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579036Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1579075Protein Lactate dehydrogenase [51859] (18 species)
  7. 1579100Species Cryptosporidium parvum [TaxId:5807] [225185] (4 PDB entries)
  8. 1579103Domain d2frma1: 2frm A:17-164 [204261]
    Other proteins in same PDB: d2frma2, d2frmb2, d2frmc2, d2frmd2
    automated match to d1ez4a1

Details for d2frma1

PDB Entry: 2frm (more details), 2.1 Å

PDB Description: Crystal structure of the lactate dehydrogenase from cryptosporidium parvum
PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d2frma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frma1 c.2.1.5 (A:17-164) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
tnpldvmvshfqkvsglphnkvcgma

SCOPe Domain Coordinates for d2frma1:

Click to download the PDB-style file with coordinates for d2frma1.
(The format of our PDB-style files is described here.)

Timeline for d2frma1: