Class a: All alpha proteins [46456] (285 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (40 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:258594] [225205] (2 PDB entries) |
Domain d2fr7a_: 2fr7 A: [204260] automated match to d4do1d_ complexed with hem |
PDB Entry: 2fr7 (more details), 2.01 Å
SCOPe Domain Sequences for d2fr7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fr7a_ a.104.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]} hgagvphlgidpfaldyfadpypeqetlreagpvvyldkwnvygvaryaevyavlndplt fcssrgvglsdfkkekpwrppslileadppahtrtravlskvlspatmkrlrdgfaaaad akidellarggnidaiadlaeayplsvfpdamglkqegrenllpyaglvfnafgppnelr qsaiersaphqayvaeqcqrpnlapggfgacihafsdtgeitpeeapllvrsllsagldt tvngiaaavyclarfpdefarlradpslarnafeeavrfespvqtffrtttrdvelagat igegekvlmflgsanrdprrwddpdryditrktsghvgfgsgvhmcvgqlvarlegevvl aalarkvaaieiagplkrrfnntlrgleslpiqltpa
Timeline for d2fr7a_: