Lineage for d2fr7a_ (2fr7 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005834Species Rhodopseudomonas palustris [TaxId:258594] [225205] (2 PDB entries)
  8. 2005836Domain d2fr7a_: 2fr7 A: [204260]
    automated match to d4do1d_
    complexed with hem

Details for d2fr7a_

PDB Entry: 2fr7 (more details), 2.01 Å

PDB Description: Crystal Structure of Cytochrome P450 CYP199A2
PDB Compounds: (A:) putative cytochrome P450

SCOPe Domain Sequences for d2fr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fr7a_ a.104.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
hgagvphlgidpfaldyfadpypeqetlreagpvvyldkwnvygvaryaevyavlndplt
fcssrgvglsdfkkekpwrppslileadppahtrtravlskvlspatmkrlrdgfaaaad
akidellarggnidaiadlaeayplsvfpdamglkqegrenllpyaglvfnafgppnelr
qsaiersaphqayvaeqcqrpnlapggfgacihafsdtgeitpeeapllvrsllsagldt
tvngiaaavyclarfpdefarlradpslarnafeeavrfespvqtffrtttrdvelagat
igegekvlmflgsanrdprrwddpdryditrktsghvgfgsgvhmcvgqlvarlegevvl
aalarkvaaieiagplkrrfnntlrgleslpiqltpa

SCOPe Domain Coordinates for d2fr7a_:

Click to download the PDB-style file with coordinates for d2fr7a_.
(The format of our PDB-style files is described here.)

Timeline for d2fr7a_: