Lineage for d1c5db1 (1c5d B:1-117)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451578Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries)
  8. 451595Domain d1c5db1: 1c5d B:1-117 [20415]
    Other proteins in same PDB: d1c5da1, d1c5da2, d1c5db2, d1c5dh2, d1c5dl1, d1c5dl2
    part of antibody against the main immunogenic region of the human muscle acetylcholine receptor

Details for d1c5db1

PDB Entry: 1c5d (more details), 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOP Domain Sequences for d1c5db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
evkllesgpglvqpsqtlsltctvsgfplttngvswvrqppgkglewiaaissggspyyn
salksrlsinrdtsksqvflkmnslqtedtaiyfctredgwnyfdywgpgtmvtvss

SCOP Domain Coordinates for d1c5db1:

Click to download the PDB-style file with coordinates for d1c5db1.
(The format of our PDB-style files is described here.)

Timeline for d1c5db1: