Lineage for d2ewda2 (2ewd A:165-333)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680348Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1680355Protein Lactate dehydrogenase [56339] (19 species)
  7. 1680383Species Cryptosporidium parvum [TaxId:5807] [225186] (4 PDB entries)
  8. 1680384Domain d2ewda2: 2ewd A:165-333 [204146]
    Other proteins in same PDB: d2ewda1, d2ewdb1
    automated match to d1ez4a2
    complexed with a3d, gol, pyr

Details for d2ewda2

PDB Entry: 2ewd (more details), 2 Å

PDB Description: Crystal structure of the Lactate Dehydrogenase from Cryptosporidium parvum complexed with substrate (Pyruvic acid) and cofactor analog (3-Acetylpyridine adenine dinucleotide).
PDB Compounds: (A:) lactate dehydrogenase,

SCOPe Domain Sequences for d2ewda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewda2 d.162.1.1 (A:165-333) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
gvldssrfrtfiaqhfgvnasdvsanvigghgdgmvpatssvsvggvplssfikqglitq
eqideivchtriawkevadnlktgtayfapaaaavkmaeaylkdkkavvpcsafcsnhyg
vkgiymgvptiigkngvedileldltpleqkllgesinevntiskvldnap

SCOPe Domain Coordinates for d2ewda2:

Click to download the PDB-style file with coordinates for d2ewda2.
(The format of our PDB-style files is described here.)

Timeline for d2ewda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ewda1