Lineage for d2dczb_ (2dcz B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780100Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2780123Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries)
  8. 2780136Domain d2dczb_: 2dcz B: [203952]
    automated match to d2b42b_
    complexed with dio, so4

Details for d2dczb_

PDB Entry: 2dcz (more details), 1.9 Å

PDB Description: thermal stabilization of bacillus subtilis family-11 xylanase by directed evolution
PDB Compounds: (B:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d2dczb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dczb_ b.29.1.11 (B:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywhfwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgcs
nvtvw

SCOPe Domain Coordinates for d2dczb_:

Click to download the PDB-style file with coordinates for d2dczb_.
(The format of our PDB-style files is described here.)

Timeline for d2dczb_: