SCOPe 2.07: Domain d2dczb_: 2dcz B:

Lineage for d2dczb_ (2dcz B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries)

8. Domain d2dczb_: 2dcz B: [203952]
   automated match to d2b42b_
   complexed with dio, so4

Details for d2dczb_

PDB Entry: 2dcz, 1.9 Å

PDB Description: thermal stabilization of bacillus subtilis family-11 xylanase by directed evolution

PDB Compounds: (B:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d2dczb_:

Sequence; same for both SEQRES and ATOM records:

>d2dczb_ b.29.1.11 (B:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywhfwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgcs
nvtvw

Timeline for d2dczb_:

• d2dczb_ first appeared in SCOPe 2.03
  
• d2dczb_ appears in SCOPe 2.06
  
• d2dczb_ appears in the current release, SCOPe 2.08