| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (239 species) not a true protein |
| Species Aeropyrum pernix [TaxId:56636] [225173] (1 PDB entry) |
| Domain d2d4ad1: 2d4a D:1-140 [203905] Other proteins in same PDB: d2d4aa2, d2d4ab2, d2d4ac2, d2d4ad2 automated match to d1guya1 |
PDB Entry: 2d4a (more details), 2.87 Å
SCOPe Domain Sequences for d2d4ad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d4ad1 c.2.1.0 (D:1-140) automated matches {Aeropyrum pernix [TaxId: 56636]}
mitilgagkvgmatavmlmmrgyddllliartpgkpqgealdlahaaaelgvdirisgsn
syedmrgsdivlvtagigrkpgmtreqlleanantmadlaekikayakdaivvittnpvd
amtyvmykktgfprervigf
Timeline for d2d4ad1: