| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
| Protein automated matches [226850] (29 species) not a true protein |
| Species Aeropyrum pernix [TaxId:56636] [225174] (1 PDB entry) |
| Domain d2d4ac2: 2d4a C:141-307 [203904] Other proteins in same PDB: d2d4aa1, d2d4ab1, d2d4ac1, d2d4ad1 automated match to d1guya2 |
PDB Entry: 2d4a (more details), 2.87 Å
SCOPe Domain Sequences for d2d4ac2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d4ac2 d.162.1.0 (C:141-307) automated matches {Aeropyrum pernix [TaxId: 56636]}
sgildsarmayyisqklgvsfksvnaivlgmhgqkmfpvprlssvggvplehlmskeeie
evvsetvnagakitelrgyssnygpaaglvltveaikrdskriypyslylqgeygyndiv
aevpavigksgieriielpltedekrkfdeavqavkklvetlppqlr
Timeline for d2d4ac2: