Lineage for d2d23b1 (2d23 B:501-801)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094316Protein automated matches [190057] (26 species)
    not a true protein
  7. 2094421Species Streptomyces olivaceoviridis [TaxId:1921] [225150] (10 PDB entries)
  8. 2094431Domain d2d23b1: 2d23 B:501-801 [203875]
    Other proteins in same PDB: d2d23a2, d2d23b2
    automated match to d1xyfa2
    complexed with gol; mutant

Details for d2d23b1

PDB Entry: 2d23 (more details), 1.95 Å

PDB Description: crystal structure of ep complex of catalytic-site mutant xylanase from streptomyces olivaceoviridis e-86
PDB Compounds: (B:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d2d23b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d23b1 c.1.8.3 (B:501-801) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvshafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
n

SCOPe Domain Coordinates for d2d23b1:

Click to download the PDB-style file with coordinates for d2d23b1.
(The format of our PDB-style files is described here.)

Timeline for d2d23b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d23b2