Lineage for d2d20a2 (2d20 A:322-436)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401663Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2401897Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2401898Protein automated matches [226913] (9 species)
    not a true protein
  7. 2401985Species Streptomyces olivaceoviridis [TaxId:1921] [225151] (7 PDB entries)
  8. 2401992Domain d2d20a2: 2d20 A:322-436 [203866]
    Other proteins in same PDB: d2d20a1, d2d20b1
    automated match to d1xyfa1
    complexed with gol, npo; mutant

Details for d2d20a2

PDB Entry: 2d20 (more details), 1.85 Å

PDB Description: crystal structure of michaelis complex of catalytic-site mutant xylanase from streptomyces olivaceoviridis e-86
PDB Compounds: (A:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d2d20a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d20a2 b.42.2.0 (A:322-436) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
rcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtgngtkvqiys
cwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqrwtrt

SCOPe Domain Coordinates for d2d20a2:

Click to download the PDB-style file with coordinates for d2d20a2.
(The format of our PDB-style files is described here.)

Timeline for d2d20a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d20a1