Lineage for d2chza2 (2chz A:357-522)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1529155Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1529156Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1529157Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 1529180Protein Phoshoinositide 3-kinase (PI3K) [49570] (2 species)
  7. 1529181Species Human (Homo sapiens) [TaxId:9606] [49572] (56 PDB entries)
  8. 1529212Domain d2chza2: 2chz A:357-522 [203796]
    Other proteins in same PDB: d2chza1, d2chza3, d2chza4
    automated match to d1e8ya2
    complexed with 093

Details for d2chza2

PDB Entry: 2chz (more details), 2.6 Å

PDB Description: a pharmacological map of the pi3-k family defines a role for p110alpha in signaling: the structure of complex of phosphoinositide 3-kinase gamma with inhibitor pik-93
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d2chza2:

Sequence, based on SEQRES records: (download)

>d2chza2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsskasaespsseskgkvrllyyvnlllidhrfllr
rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn

Sequence, based on observed residues (ATOM records): (download)

>d2chza2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatn
pdkensmsisilldn

SCOPe Domain Coordinates for d2chza2:

Click to download the PDB-style file with coordinates for d2chza2.
(The format of our PDB-style files is described here.)

Timeline for d2chza2: