SCOPe 2.08: Domain d2cdga2: 2cdg A:116-193

Lineage for d2cdga2 (2cdg A:116-193)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d2cdga2: 2cdg A:116-193 [203767]
   Other proteins in same PDB: d2cdga1, d2cdgb1, d2cdgb2
   automated match to d1qrnd2

Details for d2cdga2

PDB Entry: 2cdg, 2.6 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide-specific t cell receptors (tcr 5b)

PDB Compounds: (A:) tcr 5e

SCOPe Domain Sequences for d2cdga2:

Sequence; same for both SEQRES and ATOM records:

>d2cdga2 b.1.1.2 (A:116-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnn

Timeline for d2cdga2:

• d2cdga2 first appeared in SCOPe 2.03
  
• d2cdga2 appears in SCOPe 2.07