SCOPe 2.08: Domain d2cdgb2: 2cdg B:118-246

Lineage for d2cdgb2 (2cdg B:118-246)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2cdgb2: 2cdg B:118-246 [203769]
   Other proteins in same PDB: d2cdga2
   automated match to d1lp9f2

Details for d2cdgb2

PDB Entry: 2cdg, 2.6 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide-specific t cell receptors (tcr 5b)

PDB Compounds: (B:) tcr 5e

SCOPe Domain Sequences for d2cdgb2:

Sequence; same for both SEQRES and ATOM records:

>d2cdgb2 b.1.1.0 (B:118-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlnkvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d2cdgb2:

• d2cdgb2 first appeared in SCOPe 2.03
  
• d2cdgb2 appears in SCOPe 2.07