SCOPe 2.08: Domain d2c3td1: 2c3t D:2-79

Lineage for d2c3td1 (2c3t D:2-79)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d2c3td1: 2c3t D:2-79 [203738]
   Other proteins in same PDB: d2c3ta2, d2c3tb2, d2c3tc2, d2c3td2
   automated match to d2ljra2
   mutant

Details for d2c3td1

PDB Entry: 2c3t, 2.4 Å

PDB Description: human glutathione-s-transferase t1-1, w234r mutant, apo form

PDB Compounds: (D:) glutathione s-transferase theta 1

SCOPe Domain Sequences for d2c3td1:

Sequence; same for both SEQRES and ATOM records:

>d2c3td1 c.47.1.0 (D:2-79) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glelyldllsqpcravyifakkndipfelrivdlikgqhlsdafaqvnplkkvpalkdgd
ftltesvaillyltrkyk

Timeline for d2c3td1:

• d2c3td1 first appeared in SCOPe 2.03
  
• d2c3td1 appears in SCOPe 2.07