Lineage for d2c0ta2 (2c0t A:121-223)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2571842Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2572086Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 2572087Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries)
  8. 2572090Domain d2c0ta2: 2c0t A:121-223 [203677]
    Other proteins in same PDB: d2c0ta1, d2c0ta3, d2c0ta4, d2c0tb1, d2c0tb3, d2c0tb4
    automated match to d1qcfa2
    complexed with ca, l3g

Details for d2c0ta2

PDB Entry: 2c0t (more details), 2.15 Å

PDB Description: src family kinase hck with bound inhibitor a-641359
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d2c0ta2:

Sequence, based on SEQRES records: (download)

>d2c0ta2 d.93.1.1 (A:121-223) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

Sequence, based on observed residues (ATOM records): (download)

>d2c0ta2 d.93.1.1 (A:121-223) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
fyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOPe Domain Coordinates for d2c0ta2:

Click to download the PDB-style file with coordinates for d2c0ta2.
(The format of our PDB-style files is described here.)

Timeline for d2c0ta2: