| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
| Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
| Protein Hemopoetic cell kinase Hck [55565] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries) |
| Domain d2c0ta2: 2c0t A:121-223 [203677] Other proteins in same PDB: d2c0ta1, d2c0ta3, d2c0ta4, d2c0tb1, d2c0tb3, d2c0tb4 automated match to d1qcfa2 complexed with ca, l3g |
PDB Entry: 2c0t (more details), 2.15 Å
SCOPe Domain Sequences for d2c0ta2:
Sequence, based on SEQRES records: (download)
>d2c0ta2 d.93.1.1 (A:121-223) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss
>d2c0ta2 d.93.1.1 (A:121-223) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
fyisprstfstlqelvdhykkgndglcqklsvpcmss
Timeline for d2c0ta2:
View in 3DDomains from other chains: (mouse over for more information) d2c0tb1, d2c0tb2, d2c0tb3, d2c0tb4 |