Lineage for d2bgjb2 (2bgj B:114-272)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1589855Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1589856Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 1590016Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 1590017Protein automated matches [226871] (15 species)
    not a true protein
  7. 1590073Species Rhodobacter capsulatus [TaxId:1061] [225020] (7 PDB entries)
  8. 1590082Domain d2bgjb2: 2bgj B:114-272 [203599]
    Other proteins in same PDB: d2bgja1, d2bgjb1, d2bgjc1, d2bgjd1
    automated match to d1a8pa2
    complexed with fad

Details for d2bgjb2

PDB Entry: 2bgj (more details), 2.1 Å

PDB Description: x-ray structure of the ferredoxin-nadp(h) reductase from rhodobacter capsulatus at 2.1 angstroms
PDB Compounds: (B:) ferredoxin-nadp(h) reductase

SCOPe Domain Sequences for d2bgjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgjb2 c.25.1.0 (B:114-272) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
idallpgkrlwflatgtgiapfaslmrepeayekfdevimmhacrtvaeleygrqlveal
qedpligelvegklkyyptttreefhhmgritdnlasgkvfedlgiapmnpetdramvcg
slafnvdvmkvlesyglreganseprefvvekafvgegi

SCOPe Domain Coordinates for d2bgjb2:

Click to download the PDB-style file with coordinates for d2bgjb2.
(The format of our PDB-style files is described here.)

Timeline for d2bgjb2: