SCOPe 2.06: Domain d2a5ua3: 2a5u A:525-725

Lineage for d2a5ua3 (2a5u A:525-725)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
   automatically mapped to Pfam PF00613
   this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain

6. Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48402] (65 PDB entries)

8. Domain d2a5ua3: 2a5u A:525-725 [203396]
   Other proteins in same PDB: d2a5ua1, d2a5ua2, d2a5ua4
   automated match to d1e8ya1
   complexed with qyt

Details for d2a5ua3

PDB Entry: 2a5u, 2.7 Å

PDB Description: crystal structure of human pi3kgamma complexed with as605240

PDB Compounds: (A:) Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit, gamma isoform

SCOPe Domain Sequences for d2a5ua3:

Sequence, based on SEQRES records:

>d2a5ua3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records):

>d2a5ua3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
ylrgcg

Timeline for d2a5ua3:

• d2a5ua3 first appeared in SCOPe 2.03
  
• d2a5ua3 appears in SCOPe 2.05
  
• d2a5ua3 appears in SCOPe 2.07
  
• d2a5ua3 appears in the current release, SCOPe 2.08