Lineage for d2a5ua3 (2a5u A:525-725)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725640Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 2725641Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 2725642Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries)
  8. 2725703Domain d2a5ua3: 2a5u A:525-725 [203396]
    Other proteins in same PDB: d2a5ua1, d2a5ua2, d2a5ua4
    automated match to d1e8ya1
    complexed with qyt

Details for d2a5ua3

PDB Entry: 2a5u (more details), 2.7 Å

PDB Description: crystal structure of human pi3kgamma complexed with as605240
PDB Compounds: (A:) Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit, gamma isoform

SCOPe Domain Sequences for d2a5ua3:

Sequence, based on SEQRES records: (download)

>d2a5ua3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d2a5ua3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
ylrgcg

SCOPe Domain Coordinates for d2a5ua3:

Click to download the PDB-style file with coordinates for d2a5ua3.
(The format of our PDB-style files is described here.)

Timeline for d2a5ua3: