Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (70 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:273063] [225090] (1 PDB entry) |
Domain d1x0ue2: 1x0u E:259-523 [203062] automated match to d1vrga2 |
PDB Entry: 1x0u (more details), 2.2 Å
SCOPe Domain Sequences for d1x0ue2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x0ue2 c.14.1.0 (E:259-523) automated matches {Sulfolobus tokodaii [TaxId: 273063]} meeppyidtgdpadrdatgveqivpndaakpynmreiiykivdngeflevhkhwaqniiv gfariagnvvgivannpeefggsididaadkaarfirfcdafniplislvdtpgyvpgtd qeykgiirhgakmlyafaeatvpkitvivrksyggahiamsikslgadlvyawptaeiav tgpegavrilyrkeiqqasnpddvlkqriaeyrklfanpywaaekglvddviepkdtrrv ivaglemlktkreyrypkkhgnipl
Timeline for d1x0ue2: