Lineage for d1x0ub2 (1x0u B:259-523)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2462626Species Sulfolobus tokodaii [TaxId:273063] [225090] (1 PDB entry)
  8. 2462630Domain d1x0ub2: 1x0u B:259-523 [203056]
    automated match to d1vrga2

Details for d1x0ub2

PDB Entry: 1x0u (more details), 2.2 Å

PDB Description: Crystal Structure of the carboxyl transferase subunit of putative PCC of Sulfolobus tokodaii
PDB Compounds: (B:) hypothetical methylmalonyl-CoA decarboxylase alpha subunit

SCOPe Domain Sequences for d1x0ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0ub2 c.14.1.0 (B:259-523) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
meeppyidtgdpadrdatgveqivpndaakpynmreiiykivdngeflevhkhwaqniiv
gfariagnvvgivannpeefggsididaadkaarfirfcdafniplislvdtpgyvpgtd
qeykgiirhgakmlyafaeatvpkitvivrksyggahiamsikslgadlvyawptaeiav
tgpegavrilyrkeiqqasnpddvlkqriaeyrklfanpywaaekglvddviepkdtrrv
ivaglemlktkreyrypkkhgnipl

SCOPe Domain Coordinates for d1x0ub2:

Click to download the PDB-style file with coordinates for d1x0ub2.
(The format of our PDB-style files is described here.)

Timeline for d1x0ub2: