SCOPe 2.08: Domain d1wkub1: 1wku B:42-155

Lineage for d1wkub1 (1wku B:42-155)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)

8. Domain d1wkub1: 1wku B:42-155 [202999]
   automated match to d1sh5a1

Details for d1wkub1

PDB Entry: 1wku, 1.6 Å

PDB Description: High resolution structure of the human alpha-actinin isoform 3

PDB Compounds: (B:) Alpha-actinin 3

SCOPe Domain Sequences for d1wkub1:

Sequence; same for both SEQRES and ATOM records:

>d1wkub1 a.40.1.0 (B:42-155) automated matches {Human (Homo sapiens) [TaxId: 9606]}
awekqqrktftawcnshlrkagtqienieedfrnglklmlllevisgerlprpdkgkmrf
hkianvnkaldfiaskgvklvsigaeeivdgnlkmtlgmiwtiilrfaiqdisv

Timeline for d1wkub1:

• d1wkub1 first appeared in SCOPe 2.03
  
• d1wkub1 appears in SCOPe 2.07