Lineage for d1sh5a1 (1sh5 A:7-127)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321178Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2321179Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2321180Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2321181Protein Actin binding domain of plectin [89056] (1 species)
    duplication: consists of tandem repeat of two CH domains
  7. 2321182Species Human (Homo sapiens) [TaxId:9606] [89057] (3 PDB entries)
    Uniprot Q9QXS1 182-411
  8. 2321183Domain d1sh5a1: 1sh5 A:7-127 [105543]
    Other proteins in same PDB: d1sh5a3, d1sh5b3

Details for d1sh5a1

PDB Entry: 1sh5 (more details), 2 Å

PDB Description: Crystal structure of actin-binding domain of mouse plectin
PDB Compounds: (A:) Plectin 1

SCOPe Domain Sequences for d1sh5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sh5a1 a.40.1.1 (A:7-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]}
derdrvqkktftkwvnkhlikhwraeaqrhisdlyedlrdghnlisllevlsgdslprek
grmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiqvs
g

SCOPe Domain Coordinates for d1sh5a1:

Click to download the PDB-style file with coordinates for d1sh5a1.
(The format of our PDB-style files is described here.)

Timeline for d1sh5a1: