Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (61 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [225006] (4 PDB entries) |
Domain d1vf3b2: 1vf3 B:1081-1228 [202951] Other proteins in same PDB: d1vf3a1, d1vf3b1 automated match to d1f3aa1 complexed with acy, gdn |
PDB Entry: 1vf3 (more details), 2.15 Å
SCOPe Domain Sequences for d1vf3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vf3b2 a.45.1.0 (B:1081-1228) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} lygkdlkeralidmyvggtddlmgfllsfpflsaedkvkqcafvvekatsryfpayekvl kdhgqdflvgnrlswadihlleailmveekksdalsgfpllqafkkrissiptikkflap gskrkpisddkyvetvrrvlrmyydvkp
Timeline for d1vf3b2: