SCOPe 2.06: Domain d1vf3a2: 1vf3 A:81-228

Lineage for d1vf3a2 (1vf3 A:81-228)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (61 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225006] (4 PDB entries)

8. Domain d1vf3a2: 1vf3 A:81-228 [202949]
   Other proteins in same PDB: d1vf3a1, d1vf3b1
   automated match to d1f3aa1
   complexed with acy, gdn

Details for d1vf3a2

PDB Entry: 1vf3, 2.15 Å

PDB Description: cgsta1-1 in complex with glutathione conjugate of cdnb

PDB Compounds: (A:) Glutathione S-transferase 3

SCOPe Domain Sequences for d1vf3a2:

Sequence; same for both SEQRES and ATOM records:

>d1vf3a2 a.45.1.0 (A:81-228) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lygkdlkeralidmyvggtddlmgfllsfpflsaedkvkqcafvvekatsryfpayekvl
kdhgqdflvgnrlswadihlleailmveekksdalsgfpllqafkkrissiptikkflap
gskrkpisddkyvetvrrvlrmyydvkp

Timeline for d1vf3a2:

• d1vf3a2 first appeared in SCOPe 2.03
  
• d1vf3a2 appears in SCOPe 2.05
  
• d1vf3a2 appears in SCOPe 2.07
  
• d1vf3a2 appears in the current release, SCOPe 2.08