Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.0: automated matches [191557] (1 protein) not a true family |
Protein automated matches [190961] (16 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:425067] [188581] (2 PDB entries) |
Domain d4kgnc1: 4kgn C:1-156 [202845] Other proteins in same PDB: d4kgnc2, d4kgnd2, d4kgnf2 automated match to d3e5ya_ complexed with cl, sah |
PDB Entry: 4kgn (more details), 2.15 Å
SCOPe Domain Sequences for d4kgnc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kgnc1 c.116.1.0 (C:1-156) automated matches {Burkholderia pseudomallei [TaxId: 425067]} mfnvvlvepeippntgnvirlcantgarlhlieplgfplddakmrragldyheyaqmrvh rdwdafvaaeapdparmfafttrgsgrfhdrafepgdwfvfgaetrglapalvdrfapeq rvrlpmrpgnrslnlsntvavvvfeawrqagfegga
Timeline for d4kgnc1: