Lineage for d3e5ya_ (3e5y A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.116: alpha/beta knot [75216] (1 superfamily)
core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knotSuperfamily c.116.1: alpha/beta knot [75217] (9 families) 
known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
all known members have dimeric structures
Family c.116.1.0: automated matches [191557] (1 protein)
not a true familyProtein automated matches [190961] (16 species)
not a true protein
Species Burkholderia pseudomallei [TaxId:425067] [188581] (2 PDB entries) 
Domain d3e5ya_: 3e5y A: [174682]
automated match to d1j85a_
Details for d3e5ya_
PDB Entry: 3e5y (more details), 2.4 Å
PDB Description: crystal structure of trmh family rna methyltransferase from burkholderia pseudomallei
PDB Compounds: (A:) TrmH family RNA methyltransferaseSCOPe Domain Sequences for d3e5ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e5ya_ c.116.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 425067]}
mfnvvlvepeippntgnvirlcantgarlhlieplgfplddakmrragldyheyaqmrvh
rdwdafvaaeapdparmfafttrgsgrfhdrafepgdwfvfgaetrglapalvdrfapeq
rvrlpmrpgnrslnlsntvavvvfeawrqagfegga
SCOPe Domain Coordinates for d3e5ya_:
Click to download the PDB-style file with coordinates for d3e5ya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3e5ya_:
- d3e5ya_ first appeared in SCOPe 2.01
- d3e5ya_ appears in SCOPe 2.05
- d3e5ya_ appears in SCOPe 2.07
- d3e5ya_ appears in the current release, SCOPe 2.08
View in 3D
