SCOPe 2.08: Domain d1bvlc1: 1bvl C:6-116

Lineage for d1bvlc1 (1bvl C:6-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (67 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d1bvlc1: 1bvl C:6-116 [20284]
   Other proteins in same PDB: d1bvla2, d1bvlb_, d1bvlc2, d1bvld_
   part of humanized anti-lysozyme Fv HuLys11

Details for d1bvlc1

PDB Entry: 1bvl, 2.87 Å

PDB Description: humanized anti-lysozyme fv

PDB Compounds: (C:) hulys11

SCOPe Domain Sequences for d1bvlc1:

Sequence; same for both SEQRES and ATOM records:

>d1bvlc1 b.1.1.1 (C:6-116) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
esgpglvrpsqtlsltctvsgfsltgygvnwvrqppgrglewigmiwgdgntdynsalks
rvtmlkdtsknqfslrlssvtaadtavyycarerdyrldywgqgslvtvss

Timeline for d1bvlc1:

• d1bvlc1 first appeared (with stable ids) in SCOP 1.55, called d1bvlc_
  
• d1bvlc1 appears in SCOPe 2.07