Lineage for d1bvld_ (1bvl D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740697Species Engineered (including hybrid species) [88533] (60 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 2740756Domain d1bvld_: 1bvl D: [20285]
    Other proteins in same PDB: d1bvla1, d1bvla2, d1bvlc1, d1bvlc2
    part of humanized anti-lysozyme Fv HuLys11

Details for d1bvld_

PDB Entry: 1bvl (more details), 2.87 Å

PDB Description: humanized anti-lysozyme fv
PDB Compounds: (D:) hulys11

SCOPe Domain Sequences for d1bvld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvld_ b.1.1.1 (D:) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasgnihnylawyqqkpgkapklliyytttladgvps
rfsgsgsgtdytftisslqpediatyycqhfwstprtfgqgtkveikr

SCOPe Domain Coordinates for d1bvld_:

Click to download the PDB-style file with coordinates for d1bvld_.
(The format of our PDB-style files is described here.)

Timeline for d1bvld_: