Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries) |
Domain d1g9nh1: 1g9n H:1-129 [20267] Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9ng_, d1g9nh2, d1g9nl1, d1g9nl2 part of HIV-1 neutralizing Fab 17B; binds to the CD4-induced state of gp120 complexed with nag |
PDB Entry: 1g9n (more details), 2.9 Å
SCOPe Domain Sequences for d1g9nh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9nh1 b.1.1.1 (H:1-129) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} qvqllesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeyrnngflkhwgq gtlvtvtsa
Timeline for d1g9nh1: