| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.3: C2 set domains [49142] (8 proteins) |
| Protein CD4 C2-set domains [49149] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries) |
| Domain d1g9nc2: 1g9n C:98-181 [21665] Other proteins in same PDB: d1g9nc1, d1g9ng_, d1g9nh1, d1g9nh2, d1g9nl1, d1g9nl2 domain 2 complexed with nag |
PDB Entry: 1g9n (more details), 2.9 Å
SCOPe Domain Sequences for d1g9nc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9nc2 b.1.1.3 (C:98-181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk
Timeline for d1g9nc2: