| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
| Protein automated matches [190144] (11 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
| Domain d4intc_: 4int C: [202647] Other proteins in same PDB: d4inta_, d4inte_, d4intf_, d4inti_, d4intj_, d4intk_, d4intl_, d4intm_, d4intn_, d4into_, d4ints_, d4intt_, d4intw_, d4intx_, d4inty_, d4intz_ automated match to d2zcyc_ complexed with 1g5 |
PDB Entry: 4int (more details), 2.9 Å
SCOPe Domain Sequences for d4intc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4intc_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
q
Timeline for d4intc_: