SCOPe 2.08: Domain d4inrx_: 4inr X:

Lineage for d4inrx_ (4inr X:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4inrx_: 4inr X: [202643]
   Other proteins in same PDB: d4inrb_, d4inrc1, d4inrc2, d4inrd_, d4inre_, d4inrf_, d4inrg_, d4inrh_, d4inrk_, d4inrp_, d4inrq1, d4inrq2, d4inrr_, d4inrs_, d4inrt_, d4inru_, d4inrv_, d4inry_
   automated match to d1rypk_
   complexed with 1g1

Details for d4inrx_

PDB Entry: 4inr, 2.7 Å

PDB Description: Yeast 20S proteasome in complex with the vinyl sulfone LU102

PDB Compounds: (X:) Proteasome component C11

SCOPe Domain Sequences for d4inrx_:

Sequence; same for both SEQRES and ATOM records:

>d4inrx_ d.153.1.4 (X:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddfqaq

Timeline for d4inrx_:

• d4inrx_ first appeared in SCOPe 2.03
  
• d4inrx_ appears in SCOPe 2.07