SCOP 1.63: Domain d1g9ml1: 1g9m L:1-109

Lineage for d1g9ml1 (1g9m L:1-109)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species HIV-1 neutralizing Fab 17B (human), kappa L chain [48854] (3 PDB entries)
   binds to the CD4-induced state of gp120

8. Domain d1g9ml1: 1g9m L:1-109 [20262]
   Other proteins in same PDB: d1g9mc1, d1g9mc2, d1g9mg_, d1g9mh2, d1g9ml2

Details for d1g9ml1

PDB Entry: 1g9m, 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9ml1:

Sequence; same for both SEQRES and ATOM records:

>d1g9ml1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain}
eleltqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleik

Timeline for d1g9ml1:

• d1g9ml1 first appeared (with stable ids) in SCOP 1.55
  
• d1g9ml1 appears in SCOP 1.61
  
• d1g9ml1 appears in SCOP 1.65
  
• d1g9ml1 appears in the current release, SCOPe 2.08