Lineage for d4i9ye1 (4i9y E:2-164)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416159Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2416160Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2416161Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2416500Protein automated matches [190077] (21 species)
    not a true protein
  7. 2416525Species Human (Homo sapiens) [TaxId:9606] [186915] (26 PDB entries)
  8. 2416554Domain d4i9ye1: 4i9y E:2-164 [202599]
    Other proteins in same PDB: d4i9ya2, d4i9yb2, d4i9yc2, d4i9yd2, d4i9ye2, d4i9yf2
    automated match to d4i9ya_
    complexed with cl, gol, tla

Details for d4i9ye1

PDB Entry: 4i9y (more details), 1.75 Å

PDB Description: structure of the c-terminal domain of nup358
PDB Compounds: (E:) E3 SUMO-protein ligase RanBP2

SCOPe Domain Sequences for d4i9ye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i9ye1 b.62.1.1 (E:2-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnpvvffdvcadgeplgritmelfsnivprtaenfralctgekgfgfknsifhrvipdfv
cqggditkhdgtggqsiygdkfedenfdvkhtgpgllsmanqgqntnnsqfvitlkkaeh
ldfkhvvfgfvkdgmdtvkkiesfgspkgsvcrrititecgqi

SCOPe Domain Coordinates for d4i9ye1:

Click to download the PDB-style file with coordinates for d4i9ye1.
(The format of our PDB-style files is described here.)

Timeline for d4i9ye1: