SCOPe 2.06: Domain d4i9ye1: 4i9y E:2-164

Lineage for d4i9ye1 (4i9y E:2-164)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186915] (20 PDB entries)

8. Domain d4i9ye1: 4i9y E:2-164 [202599]
   Other proteins in same PDB: d4i9ya2, d4i9yb2, d4i9yc2, d4i9yd2, d4i9ye2, d4i9yf2
   automated match to d4i9ya_
   complexed with cl, gol, tla

Details for d4i9ye1

PDB Entry: 4i9y, 1.75 Å

PDB Description: structure of the c-terminal domain of nup358

PDB Compounds: (E:) E3 SUMO-protein ligase RanBP2

SCOPe Domain Sequences for d4i9ye1:

Sequence; same for both SEQRES and ATOM records:

>d4i9ye1 b.62.1.1 (E:2-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnpvvffdvcadgeplgritmelfsnivprtaenfralctgekgfgfknsifhrvipdfv
cqggditkhdgtggqsiygdkfedenfdvkhtgpgllsmanqgqntnnsqfvitlkkaeh
ldfkhvvfgfvkdgmdtvkkiesfgspkgsvcrrititecgqi

Timeline for d4i9ye1:

• d4i9ye1 first appeared in SCOPe 2.03, called d4i9ye_
  
• d4i9ye1 was called d4i9ye_ in SCOPe 2.05
  
• d4i9ye1 appears in SCOPe 2.07
  
• d4i9ye1 appears in the current release, SCOPe 2.08