SCOPe 2.04: Domain d4i9ye_: 4i9y E:

Lineage for d4i9ye_ (4i9y E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186915] (14 PDB entries)

8. Domain d4i9ye_: 4i9y E: [202599]
   automated match to d4i9ya_
   complexed with cl, gol, tla

Details for d4i9ye_

PDB Entry: 4i9y, 1.75 Å

PDB Description: structure of the c-terminal domain of nup358

PDB Compounds: (E:) E3 SUMO-protein ligase RanBP2

SCOPe Domain Sequences for d4i9ye_:

Sequence; same for both SEQRES and ATOM records:

>d4i9ye_ b.62.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gphmtnpvvffdvcadgeplgritmelfsnivprtaenfralctgekgfgfknsifhrvi
pdfvcqggditkhdgtggqsiygdkfedenfdvkhtgpgllsmanqgqntnnsqfvitlk
kaehldfkhvvfgfvkdgmdtvkkiesfgspkgsvcrrititecgqi

Timeline for d4i9ye_:

• d4i9ye_ first appeared in SCOPe 2.03
  
• d4i9ye_ appears in SCOPe 2.05
  
• d4i9ye_ appears in the current release, SCOPe 2.08, called d4i9ye1