Lineage for d4hsva_ (4hsv A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635819Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1635820Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1635821Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1636086Protein automated matches [190403] (2 species)
    not a true protein
  7. 1636087Species Human (Homo sapiens) [TaxId:9606] [187277] (22 PDB entries)
  8. 1636096Domain d4hsva_: 4hsv A: [202466]
    automated match to d4hsvc_

Details for d4hsva_

PDB Entry: 4hsv (more details), 2.08 Å

PDB Description: Crystal Structure of CXCL4L1
PDB Compounds: (A:) Platelet factor 4 variant

SCOPe Domain Sequences for d4hsva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hsva_ d.9.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdlqclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqallykkiik
ehles

SCOPe Domain Coordinates for d4hsva_:

Click to download the PDB-style file with coordinates for d4hsva_.
(The format of our PDB-style files is described here.)

Timeline for d4hsva_: