| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) ![]() form dimers with different dimerisation modes |
| Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
| Protein automated matches [190403] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187277] (20 PDB entries) |
| Domain d4hsva_: 4hsv A: [202466] automated match to d4hsvc_ |
PDB Entry: 4hsv (more details), 2.08 Å
SCOPe Domain Sequences for d4hsva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hsva_ d.9.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdlqclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqallykkiik
ehles
Timeline for d4hsva_: