Lineage for d1bgxh1 (1bgx H:5-115)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288465Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (38 PDB entries)
    Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor
  8. 1288484Domain d1bgxh1: 1bgx H:5-115 [20245]
    Other proteins in same PDB: d1bgxh2, d1bgxl1, d1bgxl2, d1bgxt1, d1bgxt2, d1bgxt3, d1bgxt4
    part of Fab TP7 against Taq DNA polymerase
    protein/DNA complex

Details for d1bgxh1

PDB Entry: 1bgx (more details), 2.3 Å

PDB Description: taq polymerase in complex with tp7, an inhibitory fab
PDB Compounds: (H:) tp7 mab

SCOPe Domain Sequences for d1bgxh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgxh1 b.1.1.1 (H:5-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
qesgpglvkpyqslslsctvtgysitsdyawnwirqfpgnklewmgyitysgttdynpsl
ksrisitrdtsknqfflqlnsvttedtatyycaryyygywyfdvwgqgttltvss

SCOPe Domain Coordinates for d1bgxh1:

Click to download the PDB-style file with coordinates for d1bgxh1.
(The format of our PDB-style files is described here.)

Timeline for d1bgxh1: