SCOP 1.55: Domain d1bgxh1: 1bgx H:5-115

Lineage for d1bgxh1 (1bgx H:5-115)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab TP7 (mouse), kappa L chain [48850] (2 PDB entries)

8. Domain d1bgxh1: 1bgx H:5-115 [20245]
   Other proteins in same PDB: d1bgxh2, d1bgxl2, d1bgxt1, d1bgxt2, d1bgxt3, d1bgxt4

Details for d1bgxh1

PDB Entry: 1bgx, 2.3 Å

PDB Description: taq polymerase in complex with tp7, an inhibitory fab

SCOP Domain Sequences for d1bgxh1:

Sequence; same for both SEQRES and ATOM records:

>d1bgxh1 b.1.1.1 (H:5-115) Immunoglobulin (variable domains of L and H chains) {Fab TP7 (mouse), kappa L chain}
qesgpglvkpyqslslsctvtgysitsdyawnwirqfpgnklewmgyitysgttdynpsl
ksrisitrdtsknqfflqlnsvttedtatyycaryyygywyfdvwgqgttltvss

Timeline for d1bgxh1:

• d1bgxh1 appears in SCOP 1.57
  
• d1bgxh1 appears in the current release, SCOPe 2.08